SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000256495 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000256495
Domain Number 1 Region: 49-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000144
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000256495   Gene: ENSG00000134107   Transcript: ENST00000256495
Sequence length 412
Comment pep:known chromosome:GRCh37:3:5020801:5027008:1 gene:ENSG00000134107 transcript:ENST00000256495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD
TDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
Download sequence
Identical sequences G3RIG8 H2R8H1 O14503 Q6IB83
ENSP00000256495 NP_003661.1.87134 NP_003661.1.92137 XP_004033573.1.27298 XP_516248.3.37143 ENSPTRP00000051613 gi|4503299|ref|NP_003661.1| ENSPTRP00000051613 ENSGGOP00000015470 ENSGGOP00000015470 ENSP00000256495 O14503 9606.ENSP00000256495 ENSP00000256495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]