SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265969 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265969
Domain Number 1 Region: 186-439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-57
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily POZ domain 4.19e-33
Family Tetramerization domain of potassium channels 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265969   Gene: ENSG00000129159   Transcript: ENST00000265969
Sequence length 585
Comment pep:known chromosome:GRCh37:11:17756359:17804219:1 gene:ENSG00000129159 transcript:ENST00000265969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH
PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD
SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF
EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE
TEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA
TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH
HSTQSDTCPLAQEEILEINRADSKLNGEVAKAALANEDCPHIDQALTPDEGLPFTRSGTR
ERYGPCFLLSTGEYACPPGGGMRKDLCKESPVIAKYMPTEAVRVT
Download sequence
Identical sequences A0A2K5RPN7 G1S7P7 H0X4A3 H2NDZ7 H2Q386
9606.ENSP00000265969 ENSPPYP00000003960 ENSP00000265969 gi|163792201|ref|NP_001106212.1| ENSOGAP00000010015 ENSPTRP00000005944 ENSPPYP00000003960 NP_001106212.1.87134 NP_001106212.1.92137 XP_001172719.3.37143 XP_003254331.1.23891 XP_003781198.1.62490 XP_017381313.1.71028 ENSP00000265969 ENSOGAP00000010015 ENSPTRP00000005944 ENSP00000265969 ENSNLEP00000021536 ENSNLEP00000021536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]