SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000268383 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000268383
Domain Number - Region: 25-136
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000268383   Gene: ENSG00000140743   Transcript: ENST00000268383
Sequence length 454
Comment pep:known chromosome:GRCh37:16:22357257:22385938:-1 gene:ENSG00000140743 transcript:ENST00000268383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQL
QEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIE
CLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEK
ITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGAT
GAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPE
SHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKY
EELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPP
EYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS
Download sequence
Identical sequences Q01850
9606.ENSP00000268383 NP_001793.1.87134 NP_001793.1.92137 XP_005276559.1.87134 ENSP00000268383 gi|55770832|ref|NP_001793.1| ENSP00000268383 NYSGRC-55770832 ENSP00000268383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]