SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000269593 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000269593
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-24
Family Growth factor receptor domain 0.00000222
Further Details:      
 
Domain Number 2 Region: 169-252
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.03e-23
Family Thyroglobulin type-1 domain 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000269593   Gene: ENSG00000141753   Transcript: ENST00000269593
Sequence length 258
Comment pep:known chromosome:GRCh37:17:38599713:38613983:1 gene:ENSG00000141753 transcript:ENST00000269593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDE
GDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHR
ALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGG
LEPKGELDCHQLADSFRE
Download sequence
Identical sequences A0A024R1U8 A0A0D9S313 A0A2K5MCV1 A0A2K5VE67 A0A2K6DN41 F7HF07 G1QN01 G3R338 K7DL52 P22692
NP_001247475.1.72884 NP_001543.2.87134 NP_001543.2.92137 XP_003278315.1.23891 XP_004041820.1.27298 XP_005584157.1.63531 XP_008010978.1.81039 XP_011723542.1.29376 XP_011901924.1.92194 ENSNLEP00000002317 9544.ENSMMUP00000012284 9606.ENSP00000269593 ENSNLEP00000002317 ENSP00000269593 ENSP00000269593 ENSP00000269593 ENSMMUP00000012284 ENSMMUP00000012284 gi|62243290|ref|NP_001543.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]