SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000280551 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000280551
Domain Number 1 Region: 437-682
Classification Level Classification E-value
Superfamily vWA-like 5.41e-70
Family Trunk domain of Sec23/24 0.00012
Further Details:      
 
Domain Number 2 Region: 196-454
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.18e-38
Family beta-sandwich domain of Sec23/24 0.0048
Further Details:      
 
Domain Number 3 Region: 685-780
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.62e-36
Family beta-sandwich domain of Sec23/24 0.0016
Further Details:      
 
Domain Number 4 Region: 887-1028
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.02e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.0015
Further Details:      
 
Domain Number 5 Region: 781-886
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.1e-29
Family Helical domain of Sec23/24 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000280551   Gene: ENSG00000150961   Transcript: ENST00000280551
Sequence length 1032
Comment pep:known chromosome:GRCh37:4:119643978:119757293:-1 gene:ENSG00000150961 transcript:ENST00000280551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPG
PPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSSYPGPISTSSVTQL
GSQLSAMQINSYGSGMAPPSQGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNG
PGASPLPLPMYRPDGLSGPPPPNAQYQPPPLPGQTLGAGYPPQQANSGPQMAGAQLSYPG
GFPGGPAQMAGPPQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDCM
IQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESGP
VRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLG
SYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEET
SAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLL
DQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKK
LVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYK
YNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMAA
IDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSC
ETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMK
VLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKST
MLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLP
EVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFL
CCVHKEICQLLN
Download sequence
Identical sequences O94855
ENSP00000280551 ENSP00000280551 gi|190343021|ref|NP_055637.2| 9606.ENSP00000280551 NP_055637.2.87134 NP_055637.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]