SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000282308 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000282308
Domain Number 1 Region: 304-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 528-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 569-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 416-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 8-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-20
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 9 Region: 210-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000042
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 10 Region: 89-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000155
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSP00000282308
Domain Number - Region: 164-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00251
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000282308   Gene: ENSG00000152454   Transcript: ENST00000282308
Sequence length 627
Comment pep:known chromosome:GRCh37:19:58452201:58459039:-1 gene:ENSG00000152454 transcript:ENST00000282308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAELTAPAQGIVTFEDVAVYFSWKEWGLLDEAQKCLYHDVMLENLTLTTSLGGSGAGD
EEAPYQQSTSPQRVSQVRIPKALPSPQKTNPCEICGPVLRQILHLVEHQGTHHGQKLYTD
GACRKQLQFTAYLHQHQKQHVGQKHFRSNGGRDMFLSSCTFEVSGKPFTCKEVGKDFLVR
SRFLQQQAAHTRKKSNRTKSAVAFHSVKNHYNWGECVKAFSYKHVRVQHQGDLIRERSYM
CSECGKSFSTSCSLSDHLRVHTSEKPYTCGECGKSYRQSSSLITHRRIHTGVRPHQCDEC
GKLFNRKYDLLIHQRVHTGERPYKCSECGKSFSHSSSLITHQRIHTGMRPYECSECGKSF
IHSSSLITHQRVHTGTRPYMCSECGKSFSQSCHLIKHRRLHIGEGPYECSECGKLFTYRS
RFFQHQRVHTGVRSHECHECGKLFSRKFDLIVHERVHTGERPYECSECGKSFTCKSYLIS
HWKVHTGARPYECGECGKSFTHSSTLLQHQRVHTGERPYECNECGKFFSQSSSLIRHRRS
HTGERPYECSECWKSFSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNLTNHQRIHSGE
RPYECSDCGKFFTFNSNLLKHQNVHKG
Download sequence
Identical sequences Q9Y2P7
9606.ENSP00000282308 ENSP00000282308 ENSP00000282308 NP_005764.2.87134 NP_005764.2.92137 gi|37574603|ref|NP_005764.2| ENSP00000282308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]