SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000287820 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000287820
Domain Number 1 Region: 240-503
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-82
Family Nuclear receptor ligand-binding domain 0.000000000165
Further Details:      
 
Domain Number 2 Region: 136-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.2e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000287820   Gene: ENSG00000132170   Transcript: ENST00000287820
Sequence length 505
Comment pep:known chromosome:GRCh37:3:12392971:12475855:1 gene:ENSG00000132170 transcript:ENST00000287820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Download sequence
Identical sequences P37231
gi|20336229|ref|NP_056953.2| ENSP00000380210 9606.ENSP00000287820 NP_056953.2.87134 NP_056953.2.92137 ENSP00000287820 HR4464 ENSP00000287820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]