SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000293195 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000293195
Domain Number 1 Region: 139-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-54
Family C-terminal domain of adrenodoxin reductase-like 0.00000000619
Further Details:      
 
Domain Number 2 Region: 37-198
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.71e-20
Family N-terminal domain of adrenodoxin reductase-like 0.00000597
Further Details:      
 
Domain Number 3 Region: 335-490
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000541
Family N-terminal domain of adrenodoxin reductase-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000293195   Gene: ENSG00000161513   Transcript: ENST00000293195
Sequence length 491
Comment pep:known chromosome:GRCh37:17:72858619:72869148:-1 gene:ENSG00000161513 transcript:ENST00000293195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVP
ELREAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAV
ILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKE
LREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASAS
RAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSI
GYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLV
DPQEMLRLLGH
Download sequence
Identical sequences P22570 Q6GSK2
ENSP00000293195 gi|111118981|ref|NP_077728.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]