SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000297350 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000297350
Domain Number 1 Region: 207-287
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000606
Family DEATH domain, DD 0.027
Further Details:      
 
Domain Number 2 Region: 32-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000173
Family TNF receptor-like 0.0063
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000104
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 293-371
Classification Level Classification E-value
Superfamily DEATH domain 0.00000132
Family DEATH domain, DD 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000297350   Gene: ENSG00000164761   Transcript: ENST00000297350
Sequence length 401
Comment pep:known chromosome:GRCh37:8:119935796:119964439:-1 gene:ENSG00000164761 transcript:ENST00000297350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT
VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK
HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT
HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT
VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences O00300
NP_002537.3.87134 NP_002537.3.92137 ENSP00000297350 9606.ENSP00000297350 gi|148743793|ref|NP_002537.3| ENSP00000297350 ENSP00000297350 GO.43425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]