SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000298972 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000298972
Domain Number 1 Region: 225-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-57
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 7-39,88-160
Classification Level Classification E-value
Superfamily POZ domain 1.1e-28
Family Tetramerization domain of potassium channels 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000298972   Gene: ENSG00000166006   Transcript: ENST00000298972
Sequence length 613
Comment pep:known chromosome:GRCh37:12:75433896:75603511:-1 gene:ENSG00000166006 transcript:ENST00000298972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT
GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG
DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL
VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVL
SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKDNCKEVV
ITGYTQAEARSLT
Download sequence
Identical sequences A0A024RBE3 A0A2I2Z6X8 A0A2I3LCY1 A0A2J8W1D7 A0A2K5I6J0 A0A2K5MAP4 A0A2K5XC06 A0A2K6NXB7 F7EIZ1
gi|21217561|ref|NP_631874.1| ENSMMUP00000016234 NP_631874.1.87134 NP_631874.1.92137 XP_005571620.1.63531 XP_005571621.1.63531 XP_006719445.1.92137 XP_008956615.1.60992 XP_008956616.1.60992 XP_009246316.1.23681 XP_010360959.1.97406 XP_011725437.1.29376 XP_011905132.1.92194 XP_011905133.1.92194 XP_015007751.1.72884 XP_018894966.1.27298 XP_018894967.1.27298 ENSP00000298972 ENSP00000449941 ENSP00000298972 ENSP00000449941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]