SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000299481 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000299481
Domain Number 1 Region: 718-1071
Classification Level Classification E-value
Superfamily RNI-like 6.17e-86
Family 28-residue LRR 0.00000924
Further Details:      
 
Domain Number 2 Region: 8-97
Classification Level Classification E-value
Superfamily DEATH domain 5.53e-27
Family Pyrin domain, PYD 0.008
Further Details:      
 
Domain Number 3 Region: 150-264,299-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000604
Family RecA protein-like (ATPase-domain) 0.089
Further Details:      
 
Domain Number 4 Region: 661-738
Classification Level Classification E-value
Superfamily RNI-like 0.00000487
Family 28-residue LRR 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000299481   Gene: ENSG00000158077   Transcript: ENST00000299481
Sequence length 1093
Comment pep:known chromosome:GRCh37:11:7041677:7092539:1 gene:ENSG00000158077 transcript:ENST00000299481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSSSSFFPDFGLLLYLEELNKEELNTFKLFLKETMEPEHGLTPWNEVKKARREDLAN
LMKKYYPGEKAWSVSLKIFGKMNLKDLCERAKEEINWSAQTIGPDDAKAGETQEDQEAVL
GDGTEYRNRIKEKFCITWDKKSLAGKPEDFHHGIAEKDRKLLEHLFDVDVKTGAQPQIVV
LQGAAGVGKTTLVRKAMLDWAEGSLYQQRFKYVFYLNGREINQLKERSFAQLISKDWPST
EGPIEEIMYQPSSLLFIIDSFDELNFAFEEPEFALCEDWTQEHPVSFLMSSLLRKVMLPE
ASLLVTTRLTTSKRLKQLLKNHHYVELLGMSEDAREEYIYQFFEDKRWAMKVFSSLKSNE
MLFSMCQVPLVCWAACTCLKQQMEKGGDVTLTCQTTTALFTCYISSLFTPVDGGSPSLPN
QAQLRRLCQVAAKGIWTMTYVFYRENLRRLGLTQSDVSSFMDSNIIQKDAEYENCYVFTH
LHVQEFFAAMFYMLKGSWEAGNPSCQPFEDLKSLLQSTSYKDPHLTQMKCFLFGLLNEDR
VKQLERTFNCKMSLKIKSKLLQCMEVLGNSDYSPSQLGFLELFHCLYETQDKAFISQAMR
CFPKVAINICEKIHLLVSSFCLKHCRCLRTIRLSVTVVFEKKILKTSLPTNTWDGDRITH
CWQDLCSVLHTNEHLRELDLYHSNLDKSAMNILHHELRHPNCKLQKLLLKFITFPDGCQD
ISTSLIHNKNLMHLDLKGSDIGDNGVKSLCEALKHPECKLQTLRLESCNLTVFCCLNISN
ALIRSQSLIFLNLSTNNLLDDGVQLLCEALRHPKCYLERLSLESCGLTEAGCEYLSLALI
SNKRLTHLCLADNVLGDGGVKLMSDALQHAQCTLKSLVLRRCHFTSLSSEYLSTSLLHNK
SLTHLDLGSNWLQDNGVKLLCDVFRHPSCNLQDLELMGCVLTNACCLDLASVILNNPNLR
SLDLGNNDLQDDGVKILCDALRYPNCNIQRLGLEYCGLTSLCCQDLSSALICNKRLIKMN
LTQNTLGYEGIVKLYKVLKSPKCKLQVLGLCKEAFDEEAQKLLEAVGVSNPHLIIKPDCN
YHNEEDVSWWWCF
Download sequence
Identical sequences Q86W24
ENSP00000299481 ENSP00000299481 ENSP00000299481 9606.ENSP00000299481 gi|28827813|ref|NP_789792.1| NP_789792.1.87134 NP_789792.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]