SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000301454 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301454
Domain Number 1 Region: 185-458
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.22e-80
Family Mitochondrial carrier 0.0000463
Further Details:      
 
Domain Number 2 Region: 7-160
Classification Level Classification E-value
Superfamily EF-hand 2.01e-33
Family Calmodulin-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301454   Gene: ENSG00000125648   Transcript: ENST00000301454
Sequence length 468
Comment pep:known chromosome:GRCh37:19:6440075:6459746:-1 gene:ENSG00000125648 transcript:ENST00000301454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK
LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS
LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM
EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK
NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLG
LLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR
Download sequence
Identical sequences K7APP8 Q9BV35
9606.ENSP00000301454 NP_077008.2.87134 NP_077008.2.92137 HR6608 gi|48476342|ref|NP_077008.2| ENSP00000301454 ENSP00000301454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]