SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000306760 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000306760
Domain Number 1 Region: 24-241
Classification Level Classification E-value
Superfamily RNI-like 8.5e-41
Family 28-residue LRR 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000306760   Gene: ENSG00000169683   Transcript: ENST00000306688
Sequence length 670
Comment pep:known chromosome:GRCh37:17:79981178:79989027:1 gene:ENSG00000169683 transcript:ENST00000306688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEFRRSYSRLCRESGAEPQEAVLQQLHQLPRGRLDLATQSLTVETCRALGKLLPRETLC
TELVLSDCMLSEEGATLLLRGLCANTVLRFLDLKGNNLRAAGAEALGKLLQQNKSIQSLT
LEWNSLGTWDDAFATFCGGLAANGALQRLDLRNNQISHKGAEELALALKGNTTLQQLDLR
WNNVGLLGGRALMNCLPSNRTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQAR
THVLSKEVQHLREEKSKQFLDLMETIDKQREEMAKSSRASAARVGQLQEALNERHSIINA
LKAKLQMTEAALALSEQKAQDLGELLATAEQEQLSLSQRQAKELKLEQQEAAERESKLLR
DLSAANEKNLLLQNQVDELERKFRCQQEQLFQTRQEMTSMSAELKMRAIQAEERLDMEKR
RCRQSLEDSESLRIKEVEHMTRHLEESEKAMQERVQRLEAARLSLEEELSRVKAAALSER
GQAEEELIKAKSQARLEEQQRLAHLEDKLRLLAQARDEAQGACLQQKQVVAEAQTRVSQL
GLQVEGLRRRLEELQQELSLKDQERVAEVSRVRVELQEQNGRLQAELAAQEALREKAAAL
ERQLKVMASDHREALLDRESENASLREKLRLREAEIARIRDEEAQRASFLQNAVLAYVQA
SPVRTLSPPK
Download sequence
Identical sequences Q96CN5
ENSP00000306760 ENSP00000306760 NP_659436.1.87134 NP_659436.1.92137 gi|21450705|ref|NP_659436.1| 9606.ENSP00000306760 ENSP00000306760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]