SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000307479 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000307479
Domain Number 1 Region: 336-438
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.45e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 65-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 147-201,228-243,271-283
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000154
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000307479   Gene: ENSG00000172379   Transcript: ENST00000303329
Sequence length 717
Comment pep:known chromosome:GRCh37:15:80696693:80890278:1 gene:ENSG00000172379 transcript:ENST00000303329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGI
GTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQW
QSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences A0A0D9RRE5 A0A2K5TW44 A0A2K6E1D6 H9EP17 K7B2L7 Q9HBZ2 X5DQN9
ENSP00000307479 9606.ENSP00000307479 gi|68303555|ref|NP_055677.3| ENSP00000307479 NP_055677.3.87134 NP_055677.3.92137 XP_005560307.1.63531 XP_008013851.1.81039 XP_011758840.1.29376 XP_014998347.1.72884 XP_016782765.1.37143 ENSP00000307479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]