SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000308452 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000308452
Domain Number 1 Region: 312-390
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.66e-26
Family Intermediate filament protein, coiled coil region 0.00077
Further Details:      
 
Domain Number 2 Region: 82-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000293
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Domain Number 3 Region: 194-310
Classification Level Classification E-value
Superfamily Prefoldin 0.00000366
Family Prefoldin 0.009
Further Details:      
 
Weak hits

Sequence:  ENSP00000308452
Domain Number - Region: 133-225
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000308452   Gene: ENSG00000128422   Transcript: ENST00000311208
Sequence length 432
Comment pep:known chromosome:GRCh37:17:39775689:39780829:-1 gene:ENSG00000128422 transcript:ENST00000311208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSC
YSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWY
QRQAPGPARDYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALR
LSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVE
MDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI
SELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEM
EQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV
ISSREQVHQTTR
Download sequence
Identical sequences Q04695
HR6445 ENSP00000308452 ENSP00000308452 gi|4557701|ref|NP_000413.1| ENSP00000308452 NP_000413.1.87134 NP_000413.1.92137 9606.ENSP00000308452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]