SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000309812 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309812
Domain Number 1 Region: 141-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.97e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 86-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.47e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 47-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-16
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309812   Gene: ENSG00000174255   Transcript: ENST00000308095
Sequence length 273
Comment pep:known chromosome:GRCh37:3:113953483:113956425:-1 gene:ENSG00000174255 transcript:ENST00000308095 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSPKRDGLGTGDGLHSQVLQEQVSTGDNLHECDSQGPSKDTLVREGKTYKCKECGSVFNK
NSLLVRHQQIHTGVKPYECQECGKAFPEKVDFVRPMRIHTGEKPCKCVECGKVFNRRSHL
LCYRQIHTGEKPYECSECGKTFSYHSVFIQHRVTHTGEKLFGCKECGKTFYYNSSLTRHM
KIHTGEKPCKCSECGKTFTYRSVFFRHSMTHTAGKPYECKECGKGFYYSYSLTRHTRSHT
GEKPYECLEHRKDFGYHSAFAQQSKIHSGGKNL
Download sequence
Identical sequences P51504
gi|89111947|ref|NP_009067.2| NP_009067.2.87134 NP_009067.2.92137 XP_016862621.1.92137 XP_016862622.1.92137 XP_016862623.1.92137 XP_016862624.1.92137 XP_016862625.1.92137 9606.ENSP00000309812 ENSP00000309812 ENSP00000417192 ENSP00000309812 ENSP00000417192 ENSP00000483565 ENSP00000309812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]