SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000312247 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000312247
Domain Number 1 Region: 356-456
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.91e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 94-163
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.2e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 177-231,259-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000824
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000312247   Gene: ENSG00000029153   Transcript: ENST00000311001
Sequence length 622
Comment pep:known chromosome:GRCh37:12:27485988:27573466:1 gene:ENSG00000029153 transcript:ENST00000311001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFPRKRKGSDSDPS
QSGIMTEKVVEKLSQNPLTYLLSTRIEISASSGSREAHSQTEKRRRDKMNNLIEELSAMI
PQCNPMARKLDKLTVLRMAVQHLRSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFL
FVVGCERGKILFVSKSVSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKL
IDAKTGLQVHSNLHAGRTRVYSGSRRSFFCRIKSCKISVKEEHGCLPNSKKKEHRKFYTI
HCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIGRLQPYIVPQNSGEINVKPTEFITR
FAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDS
YKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFLPCSSQSSEES
SRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCR
SMSNKELFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFM
NYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences ENSP00000312247 ENSP00000312247 NP_001234931.1.87134 NP_001234931.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]