SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000318526 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000318526
Domain Number 1 Region: 11-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.66e-46
Family Fumble-like 0.0000000921
Further Details:      
 
Domain Number 2 Region: 129-150,181-306
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.09e-43
Family Fumble-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000318526   Gene: ENSG00000152782   Transcript: ENST00000322191
Sequence length 314
Comment pep:known chromosome:GRCh37:10:91342745:91403631:-1 gene:ENSG00000152782 transcript:ENST00000322191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLINGKKQTFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGK
TGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFK
FEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLD
NPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSFGNMMSKEKRDSISKEDLARATLVTITN
NIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGA
VGALLELFKMTDDK
Download sequence
Identical sequences A0A2I2ZWX6 A0A2J8WQH7 A0A2K5DGR8 H2Q291
NP_612189.2.87134 NP_612189.2.92137 XP_004049823.1.27298 XP_008948925.1.60992 XP_507906.2.37143 gi|23510398|ref|NP_612189.2| ENSP00000318526 ENSP00000318526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]