SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000319877 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000319877
Domain Number 1 Region: 225-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-56
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 7-39,88-160
Classification Level Classification E-value
Superfamily POZ domain 9.07e-29
Family Tetramerization domain of potassium channels 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000319877   Gene: ENSG00000166006   Transcript: ENST00000350228
Sequence length 558
Comment pep:known chromosome:GRCh37:12:75433897:75603511:-1 gene:ENSG00000166006 transcript:ENST00000350228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT
GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG
DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL
VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSDN
CKEVVITGYTQAEARSLT
Download sequence
Identical sequences A0A2I2ZS76 A0A2I3M2X2 A0A2J8W1F1 A0A2K5I678 A0A2K5MAL7 A0A2K5V4V6 A0A2K5XBW0 A0A2K6CMW1 A0A2K6NXC4 F7BL65
ENSP00000319877 ENSP00000319877 gi|24497458|ref|NP_715624.1| NP_715624.1.87134 NP_715624.1.92137 XP_002798727.1.72884 XP_005571628.1.63531 XP_008956623.1.60992 XP_008956624.1.60992 XP_009246317.1.23681 XP_010360961.1.97406 XP_011725446.1.29376 XP_011784744.1.43180 XP_011850708.1.47321 XP_011905141.1.92194 XP_018894972.1.27298 XP_018894973.1.27298 ENSMMUP00000039147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]