SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000328017 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000328017
Domain Number 1 Region: 273-418
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.64e-17
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 36-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000085
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSP00000328017
Domain Number - Region: 123-240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0994
Family FCH domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000328017   Gene: ENSG00000184619   Transcript: ENST00000331336
Sequence length 492
Comment pep:known chromosome:GRCh37:17:8271973:8274858:-1 gene:ENSG00000184619 transcript:ENST00000331336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSFLVPSLVSSPVLLKLLFSPGPKTIWSLWQQPMLFQEATAFENMTKDWNYLEGSQKDC
YRDTMLDSYENTVPQGSFLQLSMMPQRAGNDPPGVSNASEMEMEISNMREKFLMSVTKLV
ESKSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEKLIEATHGE
RDRIRYYVHKEELFDILHDTHLSIGHGGRTRMLKELQGKYGNVTKEVIVLYLTLCKQCHQ
KNPVPKRGLAPKPMTFKDIDSTCQVEILDMQSSADGEFKFILYYQDHSTKFIILRPLRTK
QAHEVVSVLLDIFTILGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGS
LEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSLQQSPFEAMFGYKAKFGL
YSSNLPRETVATLQTEEELEIAEEQLENSLWIRQEERAEIGADRSDMDDDMDPTPEASEP
STSQGTSGLLCW
Download sequence
Identical sequences Q6ZNG9
9606.ENSP00000328017 NP_998762.1.87134 NP_998762.1.92137 ENSP00000379565 gi|47106061|ref|NP_998762.1| ENSP00000328017 ENSP00000328017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]