SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000328511 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000328511
Domain Number 1 Region: 303-331,363-564
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-59
Family Voltage-gated potassium channels 0.00058
Further Details:      
 
Domain Number 2 Region: 176-272
Classification Level Classification E-value
Superfamily POZ domain 8.9e-27
Family Tetramerization domain of potassium channels 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000328511   Gene: ENSG00000182255   Transcript: ENST00000328224
Sequence length 653
Comment pep:known chromosome:GRCh37:11:30031288:30038570:-1 gene:ENSG00000182255 transcript:ENST00000328224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRE
LSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVI
NVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGR
LKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYP
ESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGLLNDTSAPHLE
NSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLG
TDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGL
LIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIV
GSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSS
TSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
Download sequence
Identical sequences A0A2J8P4B6 P22459
9598.ENSPTRP00000006016 9606.ENSP00000328511 NP_002224.1.87134 NP_002224.1.92137 XP_003830475.1.60992 XP_003830476.1.60992 XP_521876.2.37143 ENSP00000328511 ENSPTRP00000006016 ENSP00000328511 ENSP00000328511 gi|4504817|ref|NP_002224.1| ENSPTRP00000006016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]