SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000329418 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000329418
Domain Number 1 Region: 71-172
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 165-210
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000196
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000329418   Gene: ENSG00000185338   Transcript: ENST00000332029
Sequence length 211
Comment pep:known chromosome:GRCh37:16:11348262:11350036:-1 gene:ENSG00000185338 transcript:ENST00000332029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences G3RFJ3 O15524 Q4JHT5
HR3086 9606.ENSP00000329418 gi|4507233|ref|NP_003736.1| ENSP00000329418 ENSP00000329418 NP_003736.1.87134 NP_003736.1.92137 XP_018868151.1.27298 ENSP00000329418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]