SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000329990 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000329990
Domain Number 1 Region: 126-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.27e-60
Family Ankyrin repeat 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000329990   Gene: ENSG00000237375   Transcript: ENST00000327822
Sequence length 584
Comment pep:known supercontig:GRCh37:GL000213.1:108007:139339:-1 gene:ENSG00000237375 transcript:ENST00000327822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAEVCSMPTASTVKKPFDLRSKMGKWCHHRFPCCRGSGKSNMGTSGDHDDSFMKMLRSK
MGKCCRHCFPCCRGSGTSNVGTSGDHENSFMKMLRSKMGKWCCHCFPCCRGSSKSNVGAW
GDYDHSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKEKRTALHLA
SANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAIQCQEDECVLMLLEHGADRNIPDEYGN
TALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQQVVKFLIKKKANLNV
LDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVICELLSDY
KEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIK
KHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRKPENQQFPDTENEEYHSDEQNDTRKQL
SEEQNTGISQDEILTNKQKQIEVAEQKMNSELSLSHKKEEDLLRENSVLQEEIAVLRLEL
DETKHQNQLRENKILEEIESVKEKTDKLLRAMQLNEEALTKTNI
Download sequence
Identical sequences ENSP00000329990 NP_001244291.1.92137 ENSP00000479139 gi|239747114|ref|XP_002343914.1| ENSP00000329990 9606.ENSP00000329990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]