SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000330031 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000330031
Domain Number 1 Region: 424-882
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.78e-117
Family PIWI domain 0.00075
Further Details:      
 
Domain Number 2 Region: 126-446
Classification Level Classification E-value
Superfamily PAZ domain 3.25e-74
Family PAZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000330031   Gene: ENSG00000184571   Transcript: ENST00000332271
Sequence length 882
Comment pep:known chromosome:GRCh37:22:25115001:25170683:-1 gene:ENSG00000184571 transcript:ENST00000332271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRARTRARGRARRRESYQQEAPGGPRAPGSATTQEPPQLQSTPRPLQEEVPVVRPLQP
RAARGGAGGGAQSQGVKEPGPEAGLHTAPLQERRIGGVFQDLVVNTRQDMKHVKDSKTGS
EGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRTILLDQHRRKFGERHIFDGNS
LLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPTSPDCLRYYNILFRRTFKLLDFEQ
VGRNYYTKKKAIQLYRHGTSLEIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKR
TSAQAQTGNIREEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDY
YRQQHKEIVTVKKQPLLVSQGRWKKGLTGTQREPILLIPQLCHMTGLTDEICKDYSIVKE
LAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQG
RRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITM
KPAEMIEVDGDANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCT
KCPIPSQCVVKKTLEKVQARTIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIV
NRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVI
VYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNFTLAFIVVKKRINTRFFLKHGSNFQNP
PPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLSPDTVQRLTYCLCHMY
YNLPGIIRVPAPCHYAHKLAYLVGQSIHQEPNRSLSTRLFYL
Download sequence
Identical sequences Q7Z3Z3
gi|153792298|ref|NP_001008496.2| ENSP00000330031 9606.ENSP00000330031 ENSP00000330031 NP_001008496.2.87134 NP_001008496.2.92137 ENSP00000330031 ENSP00000479524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]