SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000331201 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000331201
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 2.04e-46
Family VHS domain 0.0000686
Further Details:      
 
Domain Number 2 Region: 159-221
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSP00000331201
Domain Number - Region: 407-560
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00366
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000331201   Gene: ENSG00000185359   Transcript: ENST00000329138
Sequence length 777
Comment pep:known chromosome:GRCh37:17:79650962:79669149:1 gene:ENSG00000185359 transcript:ENST00000329138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASS
APPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ
PGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDA
RGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQE
KERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVE
GSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAY
SSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPS
QDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD
Download sequence
Identical sequences A0A0S2Z4R4 O14964
ENSP00000331201 ENSP00000331201 gi|4758528|ref|NP_004703.1| ENSP00000331201 NP_004703.1.87134 NP_004703.1.92137 9606.ENSP00000331201 HR3651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]