SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000332296 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000332296
Domain Number 1 Region: 130-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-78
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 77-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.46e-27
Family Nuclear receptor 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332296   Gene: ENSG00000077092   Transcript: ENST00000330688
Sequence length 448
Comment pep:known chromosome:GRCh37:3:25469802:25639423:1 gene:ENSG00000077092 transcript:ENST00000330688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
Download sequence
Identical sequences A0A1D5QJY1 A0A2I3MGX5 A0A2I3T0W6 A0A2J8WZ19 A0A2K5JFA9 A0A2K5NBP9 A0A2K5WS97 A0A2K5Z0E7 A0A2K6DR22 A0A2K6KJW1 A0A2K6QW41 F1D8S6 G3S8K4
9606.ENSP00000332296 ENSPTRP00000025352 ENSP00000332296 NP_000956.2.87134 NP_000956.2.92137 XP_001164404.1.37143 XP_002814046.2.23681 XP_003826204.1.60992 XP_004033801.1.27298 XP_005545686.1.63531 XP_010356303.1.97406 XP_011751754.1.29376 XP_011811636.1.43180 XP_011830194.1.47321 XP_011899226.1.92194 XP_014987783.1.72884 gi|14916494|ref|NP_000956.2| ENSPTRP00000025352 ENSP00000332296 ENSPANP00000009803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]