SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000334537 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000334537
Domain Number 1 Region: 185-428
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.57e-66
Family Mitochondrial carrier 0.0000588
Further Details:      
 
Domain Number 2 Region: 7-160
Classification Level Classification E-value
Superfamily EF-hand 1.74e-33
Family Calmodulin-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000334537   Gene: ENSG00000125648   Transcript: ENST00000334510
Sequence length 438
Comment pep:known chromosome:GRCh37:19:6443573:6459746:-1 gene:ENSG00000125648 transcript:ENST00000334510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK
LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS
LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM
EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK
NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQDVSVYKTDTVPTL
IELTGRRGRKMLNKSFWN
Download sequence
Identical sequences A0A2J8JRR2
ENSP00000334537 ENSP00000334537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]