SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000334798 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000334798
Domain Number 1 Region: 315-393
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-20
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 81-115
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000214
Family Intermediate filament protein, coiled coil region 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSP00000334798
Domain Number - Region: 197-313
Classification Level Classification E-value
Superfamily Prefoldin 0.000418
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000334798   Gene: ENSG00000186393   Transcript: ENST00000335552
Sequence length 468
Comment pep:known chromosome:GRCh37:17:38922490:38928414:-1 gene:ENSG00000186393 transcript:ENST00000335552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRLSGGSRRICSRTGSGRLSGGGTGFVAGNVCVGSGARSSFSCTLEGISSGGSFCNSG
GGLGSGACAGFLGNEHSLLSGNEKVTMQNLNDRLASYLDHVHALEEANADLEQKIKGWYE
KCEPGSSREHDHDYSRYFSVIEDLKRQIISATICNASIVLQNDNARLTADDFRLKYENEL
ALHHSVEADTSGLRRVLDELTLCTTDLEIQCETLSEELTYLKKSHEEEMEVLQYTAGGNV
NVEMNATPGVDLTVLLNNMRAEYEDLAEQNRKDAEAWFNERSATLQQQISDHEGAATAAR
NELTELKRNLQTLEIELQSLMAVKHSYECSLAETEGNYCNQLQQIQDQIGVMEEQLQQIR
TETEGQKLEYEQLLDVKIFLEKEIDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDS
TEETIVKTVVEELDQIGNLLSLRVHSVEEKSSKISNITVEQRVPSKAP
Download sequence
Identical sequences Q7Z3Y9
ENSP00000334798 gi|254675185|ref|NP_853517.2| ENSP00000334798 ENSP00000334798 NP_853517.2.87134 NP_853517.2.92137 9606.ENSP00000334798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]