SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000340121 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340121
Domain Number 1 Region: 225-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-57
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 7-39,88-160
Classification Level Classification E-value
Superfamily POZ domain 1.15e-28
Family Tetramerization domain of potassium channels 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340121   Gene: ENSG00000166006   Transcript: ENST00000341669
Sequence length 629
Comment pep:known chromosome:GRCh37:12:75433896:75603511:-1 gene:ENSG00000166006 transcript:ENST00000341669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT
GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG
DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL
VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVL
SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKVLYRIYH
GLLTAEKGTVEFSHTKDYTGNRLLLLNVP
Download sequence
Identical sequences A0A024RBF2 A0A2I2Y5C0 A0A2I3HWY6 A0A2I3RDT5 A0A2J8W1E2
NP_001247427.1.87134 NP_001247427.1.92137 XP_004053637.1.27298 XP_009246315.1.23681 XP_016779346.1.37143 ENSP00000448301 ENSP00000340121 ENSP00000448301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]