SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000343464 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343464
Domain Number 1 Region: 57-82,127-168
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000069
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 167-210
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000418
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343464   Gene: ENSG00000187821   Transcript: ENST00000338875
Sequence length 327
Comment pep:known chromosome:GRCh37:4:185940083:185941926:1 gene:ENSG00000187821 transcript:ENST00000338875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKLKERKVSRLSPNGTCALVVEASDSPTRHLGGPMAGKCPHGTLSVEESRVRTPVSHK
VIEKRRRDRINRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPDQQALGR
CEGPFLLLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECM
KNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPE
FAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGL
DRHYLNLIGHAHPNALNLHTPQHPPVL
Download sequence
Identical sequences A0A087WSW0
gi|71274142|ref|NP_001025058.1| ENSP00000343464 ENSP00000426033 ENSP00000343464 9606.ENSP00000343464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]