SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344914 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344914
Domain Number 1 Region: 775-972
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-47
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 1036-1233
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-45
Family BAR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 244-310
Classification Level Classification E-value
Superfamily SH3-domain 1.12e-17
Family SH3-domain 0.00095
Further Details:      
 
Domain Number 4 Region: 1530-1598
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-17
Family SH3-domain 0.0000147
Further Details:      
 
Domain Number 5 Region: 1301-1378
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-16
Family SH3-domain 0.00000659
Further Details:      
 
Domain Number 6 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 7 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000893
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 8 Region: 68-134
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000104
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344914   Gene: ENSG00000107554   Transcript: ENST00000342239
Sequence length 1601
Comment pep:known chromosome:GRCh37:10:101635334:101769676:-1 gene:ENSG00000107554 transcript:ENST00000342239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCICEFTSQELDNLPLHRGDLVILDGIPTAGWLQGRSCWGARGFFPSSC
VRELCLSSQSRQWHSQSALFQIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGNQDDCIVNGEVDTPVGEEEIGPDED
EEEPGTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLC
PDTRVEETMALPQEGSLARIPETSLDCLENTLGVEEQRHETSDHEAEEPDCIISEAPTSP
LGHLTSEYDTDRNSYQDEDTAGGPPRSPGVEWEMPLATDSPTSDPTEVVNGISSQPQVPF
HPNLQKSQYYSTVGGSHPHSEQYPDLLPLEARTRDYASLPPKRMYSQLKTLQKPVLPLYR
GSSVSASRVVKPRQSSPQLHNLASYTKKHHTSSVYSISERLEMKPGPQAQGLVMEAATHS
QGDGSTDLDSKLTQQLIEFEKSLAGPGTEPDKILRHFSIMDFNSEKDIVRGSSKLITEQE
LPERRKALRPPPPRPCTPVSTSPHLLVDQNLKPAPPLVVRPSRPAPLPPSAQQRTNAVSP
KLLSRHRPTCETLEKEGPGHMGRSLDQTSPCPLVLVRIEEMERDLDMYSRAQEELNLMLE
EKQDESSRAETLEDLKFCESNIESLNMELQQLREMTLLSSQSSSLVAPSGSVSAENPEQR
MLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNMQMVIKVSKQ
LLAALEISDAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADL
KSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEI
NVNINEYKRRKDLGKNSIIAEKEYAHAEESAFLTYSLVLKYRKGDEDSLMEKISKLNIHS
IIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESAC
VKVVAAVSMWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTG
PHKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQ
GLFTNCVHGYAEAHCDFVHQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFT
FFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNF
NAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDAS
VGSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSGSCQKQPQDASPPPKECDQG
TLSASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVG
YSVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGNQVYFAVYTFKARNPNELSVSA
NQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Download sequence
Identical sequences ENSP00000344914 ENSP00000315659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]