SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345024 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345024
Domain Number 1 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-27
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 220-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 181-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345024   Gene: ENSG00000250571   Transcript: ENST00000340042
Sequence length 376
Comment pep:known chromosome:GRCh37:8:144349607:144359099:1 gene:ENSG00000250571 transcript:ENST00000340042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQ
DVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPE
SSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGA
KPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYE
CGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQC
GKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAF
GQSSQLIQHQRVHYRE
Download sequence
Identical sequences P10075
ENSP00000345024 ENSP00000430987 ENSP00000344727 ENSP00000345024 ENSP00000430987 NP_612474.1.87134 NP_612474.1.92137 gi|20270245|ref|NP_612474.1| 9606.ENSP00000345024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]