SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345255 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345255
Domain Number 1 Region: 8-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000131
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345255   Gene: ENSG00000165084   Transcript: ENST00000348340
Sequence length 287
Comment pep:known chromosome:GRCh37:8:69243460:69448062:1 gene:ENSG00000165084 transcript:ENST00000348340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLS
GSAALWAESEKSESKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPSPDSKSLPRS
VEHPKWNWRTKPQSRDFDELNHILQESKKLGKALENLSRSIAISDELDKETVTFNSSLLR
PRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQQ
QQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDNEDDAMELLGNFKN
Download sequence
Identical sequences A0A2J8KZV1
ENSP00000345255 ENSP00000345255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]