SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345479 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345479
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 473-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 11-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 514-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 235-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000379
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 323-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000043
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 90-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000549
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 208-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000305
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345479   Gene: ENSG00000198466   Transcript: ENST00000339656
Sequence length 575
Comment pep:known chromosome:GRCh37:19:58361225:58376480:1 gene:ENSG00000198466 transcript:ENST00000339656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPRRPTQQGTVTFEDVAVNFSQEEWCLLSEAQRCLYRDVMLENLALISSLGCWCGS
KDEEAPCKQRISVQRESQSRTPRAGVSPKKAHPCEMCGLILEDVFHFADHQETHHKQKLN
RSGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVKKRKLRVSQEPFVFREFGKDVL
PSSGLCQEEAAVEKTDSETMHGPPFQEGKTNYSCGKRTKAFSTKHSVIPHQKLFTRDGCY
VCSDCGKSFSRYVSFSNHQRDHTAKGPYDCGECGKSYSRKSSLIQHQRVHTGQTAYPCEE
CGKSFSQKGSLISHQLVHTGEGPYECRECGKSFGQKGNLIQHQQGHTGERAYHCGECGKS
FRQKFCFINHQRVHTGERPYKCGECGKSFGQKGNLVHHQRGHTGERPYECKECGKSFRYR
SHLTEHQRLHTGERPYNCRECGKLFNRKYHLLVHERVHTGERPYACEVCGKLFGNKHSVT
IHQRIHTGERPYECSECGKSFLSSSALHVHKRVHSGQKPYKCSECGKSFSECSSLIKHRR
IHTGERPYECTKCGKTFQRSSTLLHHQSSHRRKAL
Download sequence
Identical sequences Q96SQ5
gi|14249532|ref|NP_116217.1| ENSP00000392410 ENSP00000345479 NP_116217.1.87134 NP_116217.1.92137 ENSP00000345479 9606.ENSP00000345479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]