SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 75_37 > ENSP00000346269

Domain assignment for ENSP00000346269 from Homo sapiens 75_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000346269
Domain Number 1	Region: 324-395
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	4.01e-21
Family	Intermediate filament protein, coiled coil region	0.00077
Further Details:

Domain Number 2	Region: 124-158
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	0.0000000000256
Family	Intermediate filament protein, coiled coil region	0.0017
Further Details:

Domain Number 3	Region: 165-234
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	0.00000183
Family	Intermediate filament protein, coiled coil region	0.008
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000346269 Gene: ENSG00000170486 Transcript: ENST00000354310
Sequence length	469
Comment	pep:known chromosome:GRCh37:12:52979498:52995322:-1 gene:ENSG00000170486 transcript:ENST00000354310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSRQLTHFPRGERLGFSGCSAVLSGGIGSSSASFRARVKGSASFGSKSLSCLGGSRSLAL SAAARRGGGRLGGFVGTAFGSAGLGPKCPSVCPPGGIPQVTVNKSLLAPLNVEMDPEIQR VRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYI SNLQKQLEMLSGDGVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDVDAAY MNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSIVLSMDNNRDLDLDSIIAEVR AQYEEIALKSKAEAETLYQTKCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEE LARMLREYQELVSLKLALDMEIATYRKLLESEECRMSGEYPNSVSISVISSTNAGAGGAG FSMGFGASSSYSYKTAAADVKTKGSCGSELKDPLAKTSGSSCATKKASR
Download sequence
Identical sequences	NP_001139698.1.87134 NP_001139698.1.92137 gi\|226246665\|ref\|NP_001139698.1\| ENSP00000346269 ENSP00000346269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]