SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000349206 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349206
Domain Number 1 Region: 61-291
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.27e-59
Family Ankyrin repeat 0.0000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349206   Gene: ENSG00000077157   Transcript: ENST00000356764
Sequence length 386
Comment pep:known chromosome:GRCh37:1:202317856:202407370:1 gene:ENSG00000077157 transcript:ENST00000356764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEL
LQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEAVLFWPF
Download sequence
Identical sequences A0A2I2YE05 A0A2I3TSG2
NP_001161330.1.87134 NP_001161330.1.92137 XP_016791368.1.37143 ENSP00000349206 gi|268607514|ref|NP_001161330.1| ENSP00000349206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]