SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000351295 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351295
Domain Number 1 Region: 231-322
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.83e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 100-272
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351295   Gene: ENSG00000143603   Transcript: ENST00000358505
Sequence length 418
Comment pep:novel chromosome:GRCh37:1:154680428:154840795:-1 gene:ENSG00000143603 transcript:ENST00000358505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVC
AIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDAS
SRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSN
FLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEK
HVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRS
VKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSL
PLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC
Download sequence
Identical sequences A0A2J8Q343 A0A2J8VG18
XP_010362984.1.97406 XP_011842822.1.47321 XP_011932125.1.92194 XP_015312095.1.63531 XP_017723188.1.44346 XP_018878770.1.27298 ENSP00000351295 ENSP00000351295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]