SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354734 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354734
Domain Number 1 Region: 68-135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 226-270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000118
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 3 Region: 132-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.000068
Family VWC domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354734   Gene: ENSG00000112761   Transcript: ENST00000361714
Sequence length 372
Comment pep:known chromosome:GRCh37:6:112375462:112392171:1 gene:ENSG00000112761 transcript:ENST00000361714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKRRLLYPSGWLHGPSDMQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAP
QRKQFCHWPCKCPQQKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDY
SVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAG
SHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRT
CGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKFVF
SGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCR
EPGDIFSELKIL
Download sequence
Identical sequences ENSP00000386467 ENSP00000464460 NP_937882.1.87134 NP_937882.1.92137 gi|38202241|ref|NP_937882.1| ENSP00000357655 NYSGRC-38202241 9606.ENSP00000354734 ENSP00000354734 ENSP00000462890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]