SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354764 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354764
Domain Number 1 Region: 239-330
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.96e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 108-280
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354764   Gene: ENSG00000143603   Transcript: ENST00000361147
Sequence length 426
Comment pep:novel chromosome:GRCh37:1:154679902:154832319:-1 gene:ENSG00000143603 transcript:ENST00000361147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPIKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILY
ISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLH
SKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYH
DQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARK
LELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFL
QAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEH
LTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPY
TSSSSC
Download sequence
Identical sequences A0A2I2ZL41 A0A2I3T4T3 A0A2J8VG12 A0A2K5MLQ7 A0A2K5WZV2 A0A2K6A5Q2 A0A2K6LQ55 A0A2K6RT72 F7ETX9
ENSP00000354764 NP_740752.1.87134 NP_740752.1.92137 XP_011842821.1.47321 XP_016783564.1.37143 XP_018878764.1.27298 gi|25777650|ref|NP_740752.1| ENSP00000354764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]