SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000354876 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354876
Domain Number 1 Region: 91-219
Classification Level Classification E-value
Superfamily Cupredoxins 9.02e-56
Family Periplasmic domain of cytochrome c oxidase subunit II 0.00000312
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 2.13e-29
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354876   Gene: ENSG00000198712   Transcript: ENST00000361739
Sequence length 227
Comment pep:known chromosome:GRCh37:MT:7586:8269:1 gene:ENSG00000198712 transcript:ENST00000361739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Download sequence
Identical sequences P00403 U5Z487
9606.ENSP00000354876 gi|251831110|ref|YP_003024029.1| ENSP00000354876 ENSP00000354876 ENSP00000354876 YP_003024029.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]