SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000356409 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356409
Domain Number 1 Region: 57-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.31e-30
Family Thioltransferase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356409   Gene: ENSG00000023572   Transcript: ENST00000367439
Sequence length 164
Comment pep:known chromosome:GRCh37:1:193065598:193074561:-1 gene:ENSG00000023572 transcript:ENST00000367439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQI
QETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERT
VPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
Download sequence
Identical sequences Q9NS18
gi|37537704|ref|NP_932066.1| ENSP00000356409 NP_932066.1.87134 NP_932066.1.92137 ENSP00000356409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]