SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356708 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356708
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356708   Gene: ENSG00000177468   Transcript: ENST00000367734
Sequence length 272
Comment pep:known chromosome:GRCh37:6:137813336:137815531:-1 gene:ENSG00000177468 transcript:ENST00000367734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAG
AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRK
LSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHP
VHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCP
CTICQMPPPPHLSALSTANMARLSAESKDLLK
Download sequence
Identical sequences Q7RTU3
gi|28411948|ref|NP_786923.1| NP_786923.1.87134 NP_786923.1.92137 ENSP00000356708 9606.ENSP00000356708 ENSP00000356708 ENSP00000356708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]