SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357068 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357068
Domain Number 1 Region: 156-340
Classification Level Classification E-value
Superfamily E set domains 3.13e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000102
Further Details:      
 
Domain Number 2 Region: 47-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.38e-19
Family Voltage-gated potassium channels 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357068   Gene: ENSG00000177807   Transcript: ENST00000368089
Sequence length 379
Comment pep:known chromosome:GRCh37:1:160007257:160040038:-1 gene:ENSG00000177807 transcript:ENST00000368089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
Download sequence
Identical sequences A0A0D9SAL7 A0A2J8JAB4 F6V197 G3S8U4 G7NWC2 H2N557 P78508
9544.ENSMMUP00000038605 9598.ENSPTRP00000051685 9600.ENSPPYP00000000752 9606.ENSP00000357068 ENSP00000357068 ENSMMUP00000038605 ENSPTRP00000051685 ENSNLEP00000016250 NP_001244805.1.72884 NP_002232.2.87134 NP_002232.2.92137 XP_002809971.3.23681 XP_003258740.1.23891 XP_004027121.1.27298 XP_004027123.1.27298 XP_005541330.1.63531 XP_007974717.1.81039 XP_008962543.1.60992 XP_009433710.1.37143 XP_010359075.1.97406 XP_011768352.1.29376 XP_011812600.1.43180 XP_011825794.1.47321 XP_011923051.1.92194 XP_011923053.1.92194 XP_012305113.1.9421 XP_014965765.1.72884 XP_014965768.1.72884 XP_017359137.1.71028 gi|25121966|ref|NP_002232.2| ENSNLEP00000016250 ENSPTRP00000051685 ENSPANP00000000927 ENSPPYP00000000752 ENSP00000357068 ENSPPYP00000000752 ENSP00000357068 ENSGGOP00000017225 ENSGGOP00000024508 ENSMMUP00000038605 ENSGGOP00000017225 ENSGGOP00000024508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]