SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357348 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357348
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000628
Family Hairy Orange domain 0.00013
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357348   Gene: ENSG00000135547   Transcript: ENST00000368364
Sequence length 337
Comment pep:known chromosome:GRCh37:6:126070726:126082415:1 gene:ENSG00000135547 transcript:ENST00000368364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF
Download sequence
Identical sequences H2QTP5 Q9UBP5
ENSP00000357348 ENSP00000357349 ENSPTRP00000031710 ENSP00000357348 NP_036391.1.87134 NP_036391.1.92137 XP_003827661.1.60992 XP_527497.3.37143 ENSPTRP00000031710 gi|6912414|ref|NP_036391.1| 9598.ENSPTRP00000031710 9606.ENSP00000357348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]