SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358784 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358784
Domain Number 1 Region: 233-258,287-484
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-60
Family Voltage-gated potassium channels 0.00041
Further Details:      
 
Domain Number 2 Region: 104-201
Classification Level Classification E-value
Superfamily POZ domain 2.88e-27
Family Tetramerization domain of potassium channels 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358784   Gene: ENSG00000177272   Transcript: ENST00000369769
Sequence length 575
Comment pep:known chromosome:GRCh37:1:111214310:111217655:-1 gene:ENSG00000177272 transcript:ENST00000369769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH
LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Download sequence
Identical sequences P22001
ENSP00000358784 9606.ENSP00000358784 ENSP00000358784 NP_002223.3.87134 NP_002223.3.92137 ENSP00000358784 gi|88758565|ref|NP_002223.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]