SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359058 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359058
Domain Number 1 Region: 173-448
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.72e-83
Family Mitochondrial carrier 0.0000296
Further Details:      
 
Domain Number 2 Region: 7-167
Classification Level Classification E-value
Superfamily EF-hand 6.39e-36
Family Calmodulin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359058   Gene: ENSG00000085491   Transcript: ENST00000370041
Sequence length 458
Comment pep:known chromosome:GRCh37:1:108677445:108735440:-1 gene:ENSG00000085491 transcript:ENST00000370041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDVNKDGKLDFEE
FMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGT
MTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLL
AGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVI
KIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVG
KTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKD
SVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEG
IPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Download sequence
Identical sequences NP_998816.1.87134 NP_998816.1.92137 ENSP00000359058 ENSP00000359058 gi|47458041|ref|NP_998816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]