SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359306 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359306
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.06e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359306   Gene: ENSG00000101199   Transcript: ENST00000370283
Sequence length 406
Comment pep:known chromosome:GRCh37:20:61904137:61921142:1 gene:ENSG00000101199 transcript:ENST00000370283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
GREWSLESSPAQNWTPPQPRTLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQG
NRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEG
PLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRS
SDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW
Download sequence
Identical sequences Q8N6T3
NP_060679.1.87134 NP_060679.1.92137 ENSP00000359306 gi|8922652|ref|NP_060679.1| ENSP00000359306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]