SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359940 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359940
Domain Number 1 Region: 1069-1163
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-23
Family I set domains 0.0037
Further Details:      
 
Domain Number 2 Region: 781-874
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 129-223
Classification Level Classification E-value
Superfamily Immunoglobulin 3.14e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 877-971
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-20
Family I set domains 0.0076
Further Details:      
 
Domain Number 5 Region: 1165-1252
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family I set domains 0.0066
Further Details:      
 
Domain Number 6 Region: 973-1067
Classification Level Classification E-value
Superfamily Immunoglobulin 4.1e-19
Family I set domains 0.0034
Further Details:      
 
Domain Number 7 Region: 418-505
Classification Level Classification E-value
Superfamily Immunoglobulin 8.13e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 320-415
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 224-318
Classification Level Classification E-value
Superfamily Immunoglobulin 6.22e-17
Family I set domains 0.0092
Further Details:      
 
Domain Number 10 Region: 688-778
Classification Level Classification E-value
Superfamily Immunoglobulin 4.2e-16
Family I set domains 0.0046
Further Details:      
 
Domain Number 11 Region: 36-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000177
Family I set domains 0.0076
Further Details:      
 
Domain Number 12 Region: 594-685
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000319
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359940   Gene: ENSG00000147255   Transcript: ENST00000370903
Sequence length 1341
Comment pep:known chromosome:GRCh37:X:130407485:130423403:-1 gene:ENSG00000147255 transcript:ENST00000370903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGEGATMLKTFTVLLFCIRMSLGMTSIVMDPQPELWIESNYPQAPWENITLWCRS
PSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKV
LELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGT
MAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAP
GESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYD
ASYRGSLLSDVLKIWVTDTFPKTWLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGED
KPLQFLDATSIDDNTSFFLNNVTYSDTGIYSCHYLLTWKTSIRMPSHNTVELMVVDKPPK
PSLSAWPSTVFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSVNGDFIISNVDGKGTG
TYSCSYRVETHPNIWSHRSEPLKLMGPAGYLTWNYVLNEAIRLSLIMQLVALLLVVLWIR
WKCRRLRIREAWLLGTAQGVTMLFIVTALLCCAISFAGLCNGVLIEETEIVMPTPKPELW
AETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHT
GSYHCHSWEEMAVSEPSEALELVGTDILPKPVISASPTIRGQELQLRCKGWLAGMGFALY
KEGEQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEM
YPKPFFKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFL
IISVGIGDGGNYSCRYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVILRC
QGTFQGMRFALLQEGAHVPLQFRSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSY
LSMPLMIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEGEATSMQLWG
STSNDGAFPITNISGTSMGRYSCCYHPDWTSSIKIQPSNTLELLVTGLLPKPSLLAQPGP
MVAPGENMTLQCQGELPDSTFVLLKEGAQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCV
YYLDSTPFAASNHSDSLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLE
HDGEEAPQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPVAQ
ECTVGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPG
TPANSPSSTSQRISVELPVPI
Download sequence
Identical sequences NP_001164432.1.87134 NP_001164432.1.92137 XP_011529632.1.92137 gi|283436131|ref|NP_001164432.1| ENSP00000359940 ENSP00000359940 ENSP00000359940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]