SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360419 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000360419
Domain Number - Region: 149-188
Classification Level Classification E-value
Superfamily RNI-like 0.0051
Family 28-residue LRR 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360419   Gene: ENSG00000116212   Transcript: ENST00000371368
Sequence length 192
Comment pep:known chromosome:GRCh37:1:54411758:54423925:1 gene:ENSG00000116212 transcript:ENST00000371368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNRE
DDTARKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDNVDHIDSLIGFPEQIAEKLFS
AAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDL
SCCKLGDEHELL
Download sequence
Identical sequences A6NL66
ENSP00000360419 ENSP00000360419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]