SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000360821 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360821
Domain Number 1 Region: 168-242
Classification Level Classification E-value
Superfamily UBA-like 2.43e-18
Family UBA domain 0.0028
Further Details:      
 
Domain Number 2 Region: 8-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000266
Family Ubiquitin-related 0.012
Further Details:      
 
Domain Number 3 Region: 279-329
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000836
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360821   Gene: ENSG00000130560   Transcript: ENST00000371756
Sequence length 405
Comment pep:known chromosome:GRCh37:9:138824815:138853226:-1 gene:ENSG00000130560 transcript:ENST00000371756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITH
HKLIHAASERVLSDARTILEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPD
KEAILRATANLPSYNMDRAAVQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKA
NAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTP
LPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKKIRRKREFRADARAVISLMEM
GFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILDNPVVQLGL
TNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Download sequence
Identical sequences A0A140VK64 Q9BSL1
ENSP00000360821 gi|55770884|ref|NP_057256.2| GO.35453 9606.ENSP00000360821 NP_057256.2.87134 NP_057256.2.92137 ENSP00000360821 ENSP00000360821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]